Dbz Big Green Dub S

Posted on

It's an official Dub alright, it's just terrible. As far as I know the only things this dub was used for was at least the first four DBZ movies because that's how I first saw them over here in the UK. If any other movies were made with the Big green Dub they were either broadcast in canada or they weren't used at all. Let's all take a minute to appreciate the fact that the Big Green Dub of DBZ exists. Thread starter. Broly movie big green dub is probably one of the funniest. Discussion I just learned about the Big Green Dub. It's incredible. And it's called the Big Green dub because Piccolo is named 'Big Green' in it. U.K hosted a. Jul 07, 2015  This dub in particular, usually referred to as the Big Green dub, was produced by AB Groupe, a French company. We know this because of the official DVDs that have been produced of this particular dub for the Bardock special, Trunks special, and most of the DBZ movies. Re: Where to buy the 'Big Green Dub' DVDs from? Post by VegettoEX » Mon Mar 10, 2014 8:39 pm I don't understand why no-one's picked me up the DBZ Movie 1 release.

  1. Dbz Big Green Dub Schedule
  2. Dbz Big Green Dub Pic
  3. Dbz Big Green Dub Songs
  4. Dbz Big Green Dub Season 2
  5. Dbz Super Episode 1 English Dub
Dragon Ball Z
ドラゴンボールZ
(Doragon Bōru Zetto)
GenreAdventure, fantasy, martial arts[1][2]
Anime television series
Directed byDaisuke Nishio(#1–199)
Shigeyasu Yamauchi (#200–291)
Produced byKenji Shimizu (#1–199)
Kōji Kaneda (#108–291)
Written by
  • Takao Koyama(chief writer)
  • Atsushi Maekawa
  • Aya Matsui
  • Hiroshi Toda
  • Katsuyuki Sumisawa
  • Keiji Terui
  • Masashi Kubola
  • Reiko Yoshida
  • Satoru Akahori
  • Sumio Uetake
  • Toshiki Inoue
  • Yoshiyuki Suga
Music byShunsuke Kikuchi
StudioToei Animation
Licensed by
Original networkFuji TV
English network
First-run syndication(1996–1998)

International Channel(1997–2002)

Cartoon Network (Toonami) (1998–2003)
Original run April 26, 1989 – January 31, 1996
Episodes291 (List of episodes)
Anime television series
Dragon Ball Z Kai
Directed byYasuhiro Nowatari (1–98)
Naohiro Terazaki (99–159~167)
Written byTakao Koyama
Music byKenji Yamamoto(1–95)
Shunsuke Kikuchi (96–98; re-aired 1–95)
Norihito Sumitomo (99–159~167)
StudioToei Animation
Licensed by
Madman Entertainment
Funimation
Manga Entertainment
Original networkFuji TV
English network
Nicktoons
Adult Swim (Toonami)
Original run April 5, 2009 – March 27, 2011
Continued run:
April 6, 2014
– June 28, 2015
Episodes159 (Japan)
167 (International)[3](List of episodes)
Dragon Ball franchise
  • Dragon Ball (manga)
  • Dragon Ball (anime)

Dragon Ball Z (Japanese: ドラゴンボールZ (ゼット)Hepburn: Doragon Bōru Zetto, commonly abbreviated as DBZ) is a Japanese anime television series produced by Toei Animation. It is the sequel to Dragon Ball and adapts the latter 325 chapters of the original 519-chapter Dragon Ball manga series created by Akira Toriyama which ran in Weekly Shōnen Jump from 1988 to 1995. Dragon Ball Z aired in Japan on Fuji TV from April 26, 1989 to January 31, 1996, before getting dubbed in territories including the United States, Canada, Australia, Europe, India, and Latin America. It was broadcast in at least 81countries worldwide.[4] It is part of the Dragon Ball media franchise.

Dragon Ball Z continues the adventures of Goku, who, along with his companions, defend the Earth against villains ranging from aliens (Frieza), androids (Cell) and other creatures (Majin Buu). While the original Dragon Ball anime followed Goku from childhood to early adulthood, Dragon Ball Z is a continuation of his adult life, but at the same time parallels the life of his son, Gohan, as well as the development of his rival Vegeta.

Due to the success of the anime in the United States, the manga chapters making up its story were initially released by Viz Media under the Dragon Ball Z title. Dragon Ball Z's popularity has spawned numerous releases which have come to represent the majority of content in the Dragon Ball franchise; including 15 movies, 2 TV specials, and 148 video games (many of them being only released in Japan), and a host of soundtracks stemming from this material. Dragon Ball Z remains a cultural icon through numerous adaptations and re-releases, including a more-recent remastered broadcast titled Dragon Ball Kai.[a] There have also been two sequel series; Dragon Ball GT (1996–1997) and Dragon Ball Super (2015–2018).

  • 2Production and broadcasting
    • 2.2Dragon Ball Z Kai
  • 4Related media
    • 4.1Home releases
  • 5Reception

Plot summary[edit]

Dragon Ball Z picks up five years after the end of the Dragon Ball anime, with Goku now a young adult and father to his son, Gohan. A humanoid alien named Raditz arrives on Earth in a spacecraft and tracks down Goku, revealing to him that he is his long-lost older brother and that they are members of a near-extinct extraterrestrial warrior race called the Saiyans (サイヤ人Saiya-jin). The Saiyans had sent Goku (originally named 'Kakarot') to Earth as an infant to conquer the planet for them, but he suffered a traumatic brain injury soon after his arrival and lost all memory of his mission, as well as his bloodthirsty Saiyan nature. Goku refuses to help Raditz continue the mission, which results in Raditz kidnapping Gohan. Goku decides to team up with his former enemy Piccolo in order to defeat Raditz and save his son, while sacrificing his own life in the process. In the afterlife, Goku trains under the ruler of the North Galaxy, King Kai, and is taught the Kaio-ken (界王拳) and Spirit Bomb (also known as the Genki Dama (元気玉)) techniques, before being revived by the Dragon Balls a year later in order to save the Earth from Raditz' allies; Nappa and the self-proclaimed 'Prince of all Saiyans', Vegeta, who arrive before Goku returns. Piccolo is killed by Nappa during the battle, along with Goku's allies Yamcha, Tien Shinhan and Chiaotzu (with Chiaotzu sacrificing himself to save Tien), and both Kami and the Dragon Balls cease to exist as a result of Piccolo's death. After Goku finally arrives at the battlefield, he avenges his fallen friends by defeating Nappa with his new level of power. Vegeta executes Nappa for his failure and does battle with Goku, but is ultimately defeated thanks to the efforts of Gohan and Goku's other surviving allies, Krillin and Yajirobe. At Goku's request, they spare Vegeta's life and allow him to escape Earth, with Vegeta vowing to return and destroy the planet out of revenge for his humiliation at Goku's hands.

Dbz big green dub ep 1

During the battle, Krillin overhears Vegeta mentioning the original set of Dragon Balls from Piccolo's homeworld, Namek (ナメック星Namekku-sei). While Goku recovers from his injuries, Gohan, Krillin and Goku's oldest friend Bulma depart for Namek in order to use these Dragon Balls to revive their fallen friends. However, they discover that Vegeta's superior, the galactic tyrant Lord Frieza, is already there, looking to use the Dragon Balls for himself so that he can achieve immortality. A fully healed Vegeta arrives on Namek as well, also seeking immortality from the Dragon Balls, which leads to several battles between him and Frieza's henchmen. Realizing he is overpowered, Vegeta teams up with Gohan and Krillin to fight the Ginyu Force, a team of elite mercenaries summoned by Frieza. After Goku finally arrives on Namek, the epic battle with Frieza himself comes to a close when Goku transforms into the fabled Super Saiyan (超サイヤ人Sūpā Saiya-jin) of legend and defeats him before escaping Namek as the planet is destroyed in a massive explosion.

Upon his return to Earth a year later, Goku encounters a time traveler named Trunks, the future son of Bulma and Vegeta, who warns Goku that two Androids (人造人間Jinzōningen, lit. 'Artificial Humans') will appear three years later, seeking revenge against Goku for destroying the Red Ribbon Army when he was a child. During this time, an evil lifeform called Cell emerges and, after absorbing two of the Androids to achieve his 'perfect form', holds his own fighting tournament to decide the fate of the Earth, known as the 'Cell Games'. After Goku sacrifices his own life a second time, to no avail, Gohan avenges his father by destroying Cell after ascending to the second level of Super Saiyan.

Seven years later, Goku is revived for one day to reunite with his loved ones and meet his youngest son, Goten, at the Tenkaichi Budōkai (天下一武道会'Strongest Under the Heavens Martial Arts Tournament'). Soon after, Goku and his allies are drawn into a fight by the Supreme Kai against a magical being named Majin Buu summoned by the evil wizard Babidi. After numerous battles that result in the deaths of many of Goku's allies as well as the destruction of Earth, Goku (whose life is fully restored by the Elder Supreme Kai) kills Kid Buu (the original and most powerful form of Majin Buu) with a Spirit Bomb attack containing the energy of all the inhabitants of Earth, who were resurrected along with the planet by the Namekian Dragon Balls. Goku makes a wish for Buu to be reincarnated as a good person and ten years later, at another Tenkaichi Budōkai, he meets Buu's human reincarnation, Uub. Leaving the match between them unfinished, Goku departs with Uub to train him to become Earth's new defender.

Production and broadcasting[edit]

Kazuhiko Torishima, Akira Toriyama's editor for Dr. Slump and the first half of Dragon Ball, felt that the Dragon Ball anime's ratings were gradually declining because it had the same producer that worked on Dr. Slump. Torishima said this producer had this 'cute and funny' image connected to Toriyama's work and was missing the more serious tone in the newer series, and therefore asked the studio to change the producer. Impressed with their work on Saint Seiya, he asked its director Kōzō Morishita and writer Takao Koyama to help 'reboot' Dragon Ball, which coincided with Goku growing up. The new producer explained that ending the first anime and creating a new one would result in more promotional money, and the result was the start of Dragon Ball Z.[5] The title was suggested by Toriyama because Z is the last letter of the alphabet and he wanted to finish the series because he was running out of ideas for it.[6] Ironically enough, the sequel series would end up producing more episodes than its predecessor.

Dragon Ball Z is adapted from the final 325 chapters of the manga series which were published in Weekly Shōnen Jump from 1988 to 1995. It premiered in Japan on Fuji Television on April 26, 1989, taking over its predecessor's time slot, and ran for 291 episodes until its conclusion on January 31, 1996.[7] Because Toriyama was writing the manga during the production of the anime,[8]Dragon Ball Z added original material not adapted from the manga, including lengthening scenes or adding new ones, and adding new attacks and characters not present in the manga. For example, Toriyama was asked to create an additional character for Goku's training with King Kai, resulting in the cricket Gregory.[9]

Throughout the production, the voice actors were tasked with playing different characters and performing their lines on cue, switching between roles as necessary.[10] The voice actors were unable to record the lines separately because of the close dialogue timing. When asked if juggling the different voices of Goku, Gohan and Goten was difficult, Masako Nozawa said that it was not, and that she was able to switch roles simply upon seeing the character's picture.[10] She did admit that when they were producing two films a year and television specials in addition to the regular series, there were times when they had only line art to look at while recording, which made giving finer nuanced details in her performance difficult.[11]

Series Director Daisuke Nishio left the series after personally directing Episode #202. Nishio left the series to become series director of Aoki Densetsu Shoot!. The role of series director was not officially filled for Episodes #200-291, despite Nishio's directing of Episode #202.[citation needed]

English dub production and broadcasting[edit]

In 1996, Funimation Productions licensed Dragon Ball Z for an English-language release in North America. They contracted Saban Entertainment to help distribute the series to television, and Pioneer Entertainment to handle home video distribution.[12] The Vancouver-based Ocean Studios were hired by Funimation to dub the anime (Funimation had previously used a similar Vancouver-based voice cast in their short-lived 1995 dub of Dragon Ball).[13] Saban musicians Ron Wasserman[14] and Jeremy Sweet,[13] known for their work on the Power Rangers franchise, composed a new background score and theme song (nicknamed 'Rock the Dragon').[Note 1] Funimation's initial English dub of Dragon Ball Z had mandated cuts to content and length, which reduced the first 67 episodes into 53.[15][16] It premiered in the United States on September 13, 1996 in first-run syndication, but halted production in 1998 after two seasons.[15] This was due to Saban scaling down its syndication operations, in order to focus on producing original material for the Fox Kids block.[17] Pioneer also ceased its home video release of the series at volume 17 (the end of the dub) and retained the rights to produce an uncut subtitled version,[15] but did not do so.

Christopher Sabat (left) and Sean Schemmel (right) have provided Funimation's English dub voices for Vegeta and Goku, respectively, since 1999.

On August 31, 1998, re-runs of this canceled dub began airing on Cartoon Network as part of the channel's weekday afternoon programming block Toonami. Due to the success of these re-runs on Toonami, Funimation resumed production on the series' English dub without Saban's assistance, but could no longer afford the services of the Ocean voice cast due to financial constraints. This led to Funimation forming its own in-house voice cast at their Texas-based studio. The Saban-produced soundtrack from the first two seasons was replaced with a new background score composed by Bruce Faulconer and his team of musicians, which was used throughout the rest of Funimation's Dragon Ball Z dub.[14] This renewed dub featured less censorship (due to both Saban's absence and fewer restrictions on cable programming) and aired on Cartoon Network's Toonami block from September 13, 1999 to April 7, 2003; continuing in re-runs through 2008. Kids' WB briefly ran Dragon Ball Z in 2001 on its short-lived Toonami block.[18]

In 2004, Pioneer lost its distribution rights to the first 53/67 episodes of Dragon Ball Z, allowing Funimation to re-dub them with their in-house voice cast and restore the removed content.[19] This dub's background score was composed by Nathan M. Johnson. Funimation's new uncut dub of these episodes aired on Cartoon Network as part of its Monday-Thursday night prime-time lineup, in a 10:30 pm late night time slot, beginning in June 2005.[20][21][22] Funimation's later remastered DVDs of the series saw minor changes made to their in-house dub for quality and consistency, mostly after the episode 67 gap, and had the option to play the entire series' dub with both the American and Japanese background music.

In January 2011, Funimation and Toei announced that they would stream Dragon Ball Z within 30 minutes before their simulcast of One Piece.[23] As of 2017, Dragon Ball Z is no longer being streamed on Hulu.

The big bang theory season 2 episode 13 torrent. The Big Bang Theory recently finished its tenth season on CBS. The network has renewed the show for another two seasons, taking the show through to its twelfth season in 2018/19. The Big Bang Theory stars Jim Parsons, Johnny Galecki, Kaley Cuoco, Simon Helberg, Kunal. The Big Bang Theory Season 12 Episode 13 HDTV – TORRENT [S12E13] [720p] January 18, 2019 This Is Us Season 3 Episode 10 HDTV – TORRENT [S03E10] [720p] January 16, 2019 FBI Season 1 Episode 11 HDTV – TORRENT [S01E11] [720p] January 16, 2019. Episode Guide:: Season 2. 201 The Bad Fish Paradigm September 22. The Hofstadter Isotope April 13, 2009; 221 The Vegas Renormalization April 27. The Big Bang Theory's second season contained twenty-three episodes aired between September 22, 2008 and May 11, 2009. The show was renewed for a further two seasons in March 2009. The Big Bang Theory Season 2 is TV series that belongs to Comedy genre, it consists of 23 episodes, you can download it on our website for free without registration using torrent program. Young Sheldon Season 2 Episode 13 HDTV – TORRENT [S02E13] [720p] January 18, 2019 How to Get Away with Murder Season 5 Episode 9 HDTV- TORRENT [S05E09] 720p January 18, 2019 Supernatural Season 14 Episode 10 HDTV – TORRENT [S14E10] [720p] January 18, 2019.

The Funimation dubbed episodes also aired in Canada, Ireland, the United Kingdom, the Netherlands, Belgium, Australia and New Zealand. However, beginning with episode 108 (123 uncut), AB Groupe and Westwood Media (in association with Ocean Studios) produced an alternate English dub. The alternate dub was created for broadcast in the UK, the Netherlands and Ireland, although it later aired in Canada. Funimation's in-house dub continued to air in the U.S., Australia and New Zealand. The Westwood Media production used the same voices from the original short-lived dub syndicated in the USA (which later aired on Toonami), it featured an alternate soundtrack by Tom Keenlyside and John Mitchell,[24] and it used the same scripts and edits as the TV edit of Funimation's in-house dub (although the UK and Europe's version was slightly edited down from this). In Australia, Dragon Ball Z was broadcast by the free-to-air commercial network, Network Ten during morning children's programming, Cheez TV, originally using the censored Funimation/Saban dub before switching to Funimation's in-house dub.Dragon Ball Z originally aired on the British Comedy Network in Fall 1998.[25]

Pokemon rom game boy advance download. Pokemon Sienna is an online retro game which you can play for free here at playretrogames.com It has the tags: rpg, adventure, action, and was added on Jan 14, 2015. It has been played 20183 times and is available for the following systems: gba / gba / Nintendo Game Boy Advance You can also play Pokemon Sienna unblocked. CoolROM.com's game information and ROM download page for Pokemon Sienna (Hack) (Gameboy Advance).

Dragon Ball Z Kai[edit]

Dragon Ball Kai promotional image; featuring Goku (center), Gohan (bottom-left), Piccolo (bottom-right), Vegeta (top-right) and Frieza (top-left).

In February 2009, Toei Animation announced that it would begin broadcasting a revised version of Dragon Ball Z as part of the series' 20th-anniversary celebrations.[26] The series premiered on Fuji TV in Japan on April 5, 2009, under the title Dragon Ball Kai (Dragon Ball Z Kai internationally). The ending suffix Kai (改「かい」) in the name means 'updated' or 'altered' and reflects the improvements and corrections of the original work.[27] The original footage was remastered for HDTV, featuring updated opening and ending sequences, new music, and a rerecording of the vocal tracks.[27][28] The original material and any damaged frames were removed to more closely follow the manga, resulting in a faster-moving story.[29] Torishima later explained the origins of Kai; Bandai was having a hard time increasing their sales and asked if a new Dragon Ball anime could be made, but Toriyama refused to create a new story (at the time). Realizing that the anime-exclusive scenes that were added to increase the distance between the original anime and the manga hurt the pacing of the series, Torishima thought of cutting them so that it faithfully followed the manga. He said the reception to Kai was positive and Bandai had a hit with a card game, so it all worked out.[30]

The series initially concluded with the finale of the Cell arc, as opposed to including the Majin Buu arc. It was originally planned to run 98 episodes, however, due to the Tōhoku offshore earthquake and tsunami, the final episode of Dragon Ball Kai was not aired and the series ended on its 97th episode in Japan on March 27, 2011. The 98th episode was later released direct-to-video in Japan on August 2, 2011.[31]

In November 2012, Mayumi Tanaka, the Japanese voice of Krillin, announced that she and the rest of the cast were recording more episodes of Dragon Ball Kai.[32] In February 2014, the Kai adaptation of the Majin Buu arc was officially confirmed. The new run of the series, which is titled Dragon Ball Z Kai: The Final Chapters internationally, began airing in Japan on Fuji TV on April 6, 2014 and ended its run on June 28, 2015.[33] The final arc of Kai was originally produced to last 69 episodes (as most of the international versions run),[34] but the Japanese broadcast cut it down to 61 episodes.

English dub production and broadcasting[edit]

Funimation licensed Kai for an English-language release in February 2010. The series was initially broadcast in the U.S. on Nicktoons from May 24, 2010 to January 1, 2012 (continuing in re-runs until April 2013).[35][36] In addition to Nicktoons, the series also began airing on the 4Kids-owned Saturday morning programming block Toonzai on The CW in August 2010,[37] then on its successor, the Saban-owned Vortexx, beginning in August 2012 until the block ended in September 2014.[33] Both the Nicktoons and CW airings were edited for content, though the CW version was censored even more so than Nicktoons. Kai began airing uncut on Adult Swim's Toonami block on November 8, 2014,[38] and re-runs of the previous week's episodes aired at the beginning of Adult Swim proper from February 2015 to June 2016.[39]CSC Media Group acquired the broadcast rights to Kai in the United Kingdom and began airing it on Kix! in early 2013.[40][41][42]

Despite Kai's continuation not being officially confirmed at the time even in Japan, Funimation voice actors Sean Schemmel (Goku) and Kyle Hebert (Gohan), announced in April 2013 that they had started recording an English dub for new episodes.[43] In November 2013, Kai's Australasian distributor Madman Entertainment revealed that the Majin Buu arc of Kai would be released in 2014 and that they were waiting on dubs to be finished.[44] In February 2014, Funimation officially stated that they had not started recording a dub for the final arc of Kai.[45] On December 6, 2016, Funimation announced the continuation of Kai to begin airing on Adult Swim's Toonami block; airing from January 7, 2017 to June 23, 2018, alongside Dragon Ball Super.[46]

Editing[edit]

Dragon Ball Z's original North American release was the subject of heavy editing which resulted in a large amount of removed content and alterations that greatly changed the original work. Funimation CEO Gen Fukunaga is often criticized for his role in the editing; but it was the initial distributor Saban which required such changes or they would not air the work, as was the case with the episode dealing with orphans.[47][Note 2] These changes included altering every aspect of the show from character names, clothing, scenes and dialogue of the show. The character Mr. Satan was renamed Hercule and this change has been retained in other English media such as Viz's Dragon Ball Z manga and video games.[48] The dialogue changes would sometimes contradict the scenes itself; after the apparent fatal explosion of a helicopter, one of the characters (most likely Tien) said, 'I can see their parachutes; they're okay!'[47] Funimation's redub for the 2005 release would address many of the issues raised by Saban, with the uncut releases preserving the integrity of the original Japanese release.

During the original Japanese TV airing of Dragon Ball Kai, scenes involving blood and brief nudity were removed. Nicktoons would also alter Kai for its broadcast; it released a preview showcasing these changes which included removing the blood and cheek scar from Bardock and altering the color of Master Roshi's alcohol.[49] The show was further edited for its broadcast on The CW; most notoriously, the character Mr. Popo was tinted blue. The show's DVD and Blu-ray releases only contained the edits present in the original Japanese version. A rumor that Cartoon Network would be airing Kai uncut was met with an official statement to debunk the rumor in June 2010;[50] though it would later air uncut on the channel as part of Adult Swim's Toonami block.

Steven Simmons, who did the subtitling for Funimation's home video releases, offered commentary on the subtitling from a project and technical standpoint, addressing several concerns.[51][Note 3] Simmons said that Gen Fukunaga did not want any swearing on the discs, but because there was no taboo word list, Simmons would substitute a variation in the strength of the words by situation with the changes starting in episode 21.[52] The typographical errors in the script were caused by dashes (—) and double-quotes (') failing to appear, which resulted in confusing dialogue.[52]

Music[edit]

Sample of 'Cha-La Head-Cha-La' performed by Hironobu Kageyama, the opening theme song for the majority of the show.
Problems playing this file? See media help.
Cover of the first Dragon Ball Z compilation soundtrack.

Shunsuke Kikuchi composed the score for Dragon Ball Z. The opening theme for the first 199 episodes is 'Cha-La Head-Cha-La' performed by Hironobu Kageyama. The second opening theme used up until the series finale at episode 291 is 'We Gotta Power' also performed by Kageyama. The ending theme used for the first 199 episodes is 'Detekoi Tobikiri Zenkai Power!' (でてこいとびきりZENKAIパワー!, 'Come Out, Incredible Full Power!') performed by MANNA. The second ending theme used for the remaining episodes is 'Bokutachi wa Tenshi Datta' (僕達は天使だった, 'We Were Angels') performed by Kageyama.

Kenji Yamamoto composed the score for Dragon Ball Kai. The opening theme, 'Dragon Soul', and the first ending theme used for the first 54 episodes, 'Yeah! Break! Care! Break!', are both performed by Takayoshi Tanimoto.[53] The second ending theme, used from episodes 55–98, is 'Kokoro no Hane' (心の羽根, 'Wings of the Heart') performed by Team Dragon, a unit of the idol girl group AKB48.[54] On March 9, 2011, Toei announced that due to Yamamoto's score infringing on the rights of an unknown third party or parties, the music for remaining episodes and reruns of previous episodes would be replaced.[55] Later reports from Toei stated that with the exception of the series' opening and closing songs, as well as eyecatch music, Yamamoto's score was replaced with Shunsuke Kikuchi's original from Dragon Ball Z. The music for the Majin Buu arc of Kai is composed by Norihito Sumitomo.[56] The opening theme is 'Kuu•Zen•Zetsu•Go' (空•前•絶•後) by Dragon Soul, while the first ending song is 'Haikei, Tsuratsusutora' (拝啓、ツラツストラ, 'Dear Zarathustra') by Japanese rock band Good Morning America,[57] and the second 'Junjō' (純情, 'Pure Heart') by Leo Ieiri from episode 112 to 123.[58] The third ending song is 'Oh Yeah!!!!!!!' by Czecho No Republic from episode 124 to 136,[59] the fourth 'Galaxy' by Kyūso Nekokami from 137 to 146, and the fifth is 'Don't Let Me Down' by Gacharic Spin from 147 to 159.[60] The international broadcast features two pieces of theme music. The opening theme, titled 'Fight It Out', is performed by rock singer Masatoshi Ono, while the ending theme is 'Never Give Up!!!', performed by rhythm and blues vocalist Junear.A second OST was created for the English Funimation release composed by Bruce Faulconer. It was used in the 2001–2005 broadcast of the show and was later released as a secondary to the Japanese OST.[61]

Related media[edit]

Home releases[edit]

In Japan, Dragon Ball Z did not receive a home video release until 2003, seven years after its broadcast. This was a remastering of the series in two 26-disc DVD box sets, that were made-to-order only, released on March 19 and September 18 and referred to as 'Dragon Boxes.' The content of these sets began being released on mass-produced individual 6-episode DVDs on November 2, 2005 and finished with the 49th volume released on February 7, 2007.[62][63]

The international home release structure of Dragon Ball Z is complicated by the licensing and release of the companies involved in producing and distributing the work. Releases of the media occurred on both VHS and DVD with separate edited and uncut versions being released simultaneously. Both versions of the edited and uncut material are treated as different entries and would frequently make Billboard rankings as separate entries. Home release sales were featured prominently on the Nielsen VideoScan charts.[19] Further complicating the release of the material was Funimation itself; which was known to release 'DVDs out of sequence in order to get them out as fast as possible'; as in the case of their third season.[64]Pioneer Entertainment distributed the Funimation/Saban edited-only dub of 53 episodes on seventeen VHS between 1997 and 1999,[65][66] and seventeen DVDs throughout 1999.[67][68] Two box sets separating them into the Saiyan and Namek arcs were also released on VHS in 1999,[69][70] and on DVD in 2001.[71][72] Funimation's own distribution of their initial in-house dub, which began with episode 54, in edited or uncut VHS ran between 2000 and 2003.[73][74][75] A DVD version was produced alongside these, although they were only produced uncut and contained the option to watch the original Japanese with subtitles.[76][77]

In 2005, Funimation began releasing their in-house dub of the beginning of Dragon Ball Z on DVD, marking the first time the episodes were seen uncut in North America.[78] However, only nine volumes were released, leaving it incomplete.[79] Instead, Funimation remastered and cropped the entire series into 16:9 widescreen format and began re-releasing it to DVD in nine individual 'season' box sets; the first set released on February 6, 2007 and the final on May 19, 2009.[80][81] In July 2009, Funimation announced that they would be releasing the Japanese frame-by-frame 'Dragon Box' restoration of Dragon Ball Z in North America. These seven limited edition collector's DVD box sets were released uncut in the show's original 4:3 fullscreen format between November 10, 2009 and October 11, 2011.[82]

In July 2011, Funimation announced plans to release Dragon Ball Z in Blu-ray format, with the first set released on November 8, 2011.[83][84][85] However, production of these 4:3 sets was suspended after the second volume, citing technical concerns over restoring the original film material frame by frame.[86] Only a year later, the company began producing a cropped 16:9 remastered Blu-ray release in 2013, with nine sets released in total.[87] On August 13, 2013, Funimation released all 53 episodes and the three movies from their first Dragon Ball Z dub created with Saban and Ocean Studios in a collector's DVD box set, titled the Rock the Dragon Edition.[88]

In March 2019, Funimation announced plans to release a 30th anniversary Blu-ray release of Dragon Ball Z, with the box set being remastered in 4:3 aspect ratio, and containing an artbook and a collectible figure.[89][90] It would be crowdfunded, originally requiring a minimum of 2500 pre-orders in order to be manufactured, but was later increased to a minimum of 3,000 units.[91] The release sparked controversy amongst fans due to the framing of the video, color saturation and digital video noise reduction.[92][93] Funimation responded by stating that they cropped the release by going in 'scene-by-scene to make judgements based on the image available in each frame of how much to trim to get to a consistent 4:3 aspect ratio, while still attempting to cut as little out of the picture as possible,' and that they felt the digital video noise reduction was 'mandatory for this release based on the different levels of fan support from various past DBZ releases with different levels of noise reduction over the years.'[94]

Kai[edit]

Dbz Big Green Dub Schedule

In Japan, Dragon Ball Kai was released in wide-screen on 33 DVDs and in fullscreen on a single Blu-ray and eight four-disc Blu-ray sets from September 18, 2009, to August 2, 2011.

Funimation released eight DVD and Blu-ray box sets of Dragon Ball Z Kai from May 18, 2010 to June 5, 2012.[95][96] These sets contain the original Japanese audio track with English subtitles, as well as the uncut version of the English dub, which does not contain any of the edits made for the TV airings. Before the final volume was even published, Funimation began re-releasing the series in four DVD and Blu-ray 'season' sets between May 22, 2012 and March 12, 2013.[97][98] Funimation released The Final Chapters in three DVD and Blu-ray volumes from April 25 to June 20, 2017.[99][100][101]

Manga[edit]

While the manga was all titled Dragon Ball in Japan, due to the popularity of the Dragon Ball Z anime in the west, Viz Media initially changed the title of the last 26 volumes of the manga to 'Dragon Ball Z' to avoid confusion. The volumes were originally published in Japan between 1988 and 1995. It began serialization in the American Shonen Jump, beginning in the middle of the series with the appearance of Trunks; the tankōbon volumes of both Dragon Ball Z and Dragon Ball were released simultaneously by Viz Media in the United States.[102][103] In March 2001, Viz continued this separation by re-shipping the Dragon Ball and Dragon Ball Z titles starting with the first volumes of each work.[104] Viz's marketing for the manga made distinct the differences between Dragon Ball and Dragon Ball Z tone. Viz billed Dragon Ball Z: 'More action-packed than the stories of Goku's youth, Dragon Ball Z is pure adrenaline, with battles of truly Earth-shaking proportions!'[105] Between 2008 and 2010, Viz re-released the two series in a format called 'Viz Big Edition,' which collects three individual volumes into a single large volume.[106] However, in 2013 Viz began publishing new 3-in-1 volumes collecting the entire manga series, including what they previously released as Dragon Ball Z, under the Dragon Ball name.[107]

Films[edit]

The Dragon Ball Z films comprise a total of 15 entries as of 2015. The first 13 films were typically released every March and July during the series' original run in accordance with the spring and summer vacations of Japanese schools. They were typically double features paired up with other anime films, and were thus, usually an hour or less in length. These films themselves offer contradictions in both chronology and design that make them incompatible with a single continuity. All 15 films were licensed in North America by Funimation, and all have received in-house dubs by the company. Prior to Funimation, the third film was a part of the short-lived Saban syndication, being split into three episodes, and the first three films received uncut English dubs in 1998 produced by Funimation with Ocean Studios and released by Pioneer. Several of the films have been broadcast on Cartoon Network and Nicktoons in the United States, Toonami UK in the United Kingdom (these featured an alternate English dub produced by an unknown cast by AB Groupe), and Cartoon Network in Australia.

Television specials and original video animations[edit]

Three TV specials based on Dragon Ball Z were produced and broadcast on Fuji TV. The first two were Dragon Ball Z: Bardock – The Father of Goku in 1990 and Dragon Ball Z: The History of Trunks in 1993, the latter being based on a special chapter of the original manga. Both were licensed by Funimation in North America and AB Groupe in Europe. In 2013, a two-part hour-long crossover with One Piece and Toriko, titled Dream 9 Toriko & One Piece & Dragon Ball Z Chō Collaboration Special!!, was created and aired.

Additionally, two original video animations (OVAs) bearing the Dragon Ball Z title have been made. The first is Dragon Ball Z Side Story: Plan to Eradicate the Saiyans, which was originally released in 1993 in two parts as 'Official Visual Guides' for the video game of the same title. Dragon Ball: Plan to Eradicate the Super Saiyans was a 2010 remake of this OVA. None of the OVAs have been dubbed into English, and the only one to see a release in North America is the 2010 remake, which was subtitled and included as a bonus feature in Dragon Ball: Raging Blast 2.

Video games[edit]

Dbz Big Green Dub Pic

There are over 57 video games bearing the Dragon Ball Z name across a range of platforms from the Nintendo Entertainment System/Famicom to the current generation consoles. Also included are arcade games like Super Dragon Ball Z, which would eventually be ported to consoles.

In North America, licensing rights had been given to both Namco Bandai and Atari. In 1999, Atari acquired exclusive rights to the video games through Funimation, a deal which was extended for five more years in 2005.[108] A 2007 dispute would end with Atari paying Funimation $3.5 million.[109] In July 2009, Namco Bandai was reported to have obtained exclusive rights to release the games for a period of five years.[110] This presumably would have taken effect after Atari's licensing rights expired at the end of January 2010.[109]

Soundtracks[edit]

Dragon Ball Z has been host to numerous soundtrack releases with works like 'Cha-La Head-Cha-La' and a series of 21 soundtracks released as part of the Dragon Ball Z Hit Song Collection Series. In total, dozens of releases exist for Dragon Ball Z which includes Japanese and foreign adapted releases of the anime themes and video game soundtracks.

Reception[edit]

In Asia, the Dragon Ball Z franchise, including the anime and merchandising, earned a profit of $3billion by 1999.[111] In the United States, the series sold over 25million DVDs as of January 2012.[112] Dragon Ball fans set a Guinness World Record for Largest Kamehameha attack move at San Diego Comic con on July 17, 2019.[113]

Cultural impact and legacy[edit]

Dragon Ball Z was listed as the 78th best animated show in IGN's 'Top 100 Animated Series',[114] and was also listed as the 50th greatest animated show in Wizard magazine's 'Top 100 Greatest Animated shows' list.[115] The series ranked #6 on Wizard's Anime Magazine on their 'Top 50 Anime released in North America'.[116]

Dbz Big Green Dub S

Dragon Ball Z's popularity is reflected through a variety of data through online interactions which show the popularity of the media. In 2001, it was reported that the official website of Dragon Ball Z recorded 4.7 million hits per day and included 500,000+ registered fans.[117] The term 'Dragonball Z' ranked 4th in 1999 and 2nd in 2000 by Lycos' web search engine.[118][119] For 2001, 'Dragonball' was the most popular search on Lycos and 'Dragonball Z' was fifth on Yahoo!.[120]

In 2005, media historianHal Erickson wrote that 'Dragon Ball may be the closest thing on American television to an animated soap opera — though this particular genre is an old, established and venerated one in Japan, the series' country of origin.'[121] In 2015, Ford Motor Company released two commercials featuring characters from the series, the first advertising the Ford Fusion and the second for the Ford Focus.[122]

Ratings[edit]

Dragon Ball Z's Japanese run was very popular with an average viewer ratings of 20.5% across the series. Dragon Ball Z also proved to be a rating success in the United States, outperforming top shows such as Friends and The X-Files in some parts of the country in sweeps ratings during its first season.[123] The premiere of season three of Dragon Ball Z in 1999, done by Funimation's in-house dub, was the highest-rated program ever at the time on Cartoon Network.[124] In 2002, in the week ending September 22, Dragon Ball Z was the #1 program of the week on all of television with tweens 9-14, boys 9-14 and men 12-24, with the Monday, Tuesday and Wednesday telecasts of Dragon Ball Z ranked as the top three programs in all of television, broadcast or cable, for delivery of boys 9-14.[125] In 2001, Cartoon Network obtained licensing to run 96 more episodes and air the original Dragon Ball anime and was the top rated show in the Toonami block of Cartoon network.[126] Beginning March 26, 2001, Cartoon Network ran a 12-week special promotion 'Toonami Reactor' which included a focus on Dragon Ball Z, which would stream episodes online to high-speed internet users.[127] Many home video releases were met with both the edited and unedited versions placing on in the top 10 video charts of Billboard. For example, 'The Dark Prince Returns' (containing episodes 226-228) and 'Rivals' (containing episodes 229-231) edited and unedited, made the Billboard magazine top video list for October 20, 2001.[128][Note 4]

The first episode of Dragon Ball Kai earned a viewer ratings percentage of 11.3, ahead of One Piece and behind Crayon Shin-chan.[129] Although following episodes had lower ratings, Kai was among the top 10 anime in viewer ratings every week in Japan for most of its run.[130][131] Towards the end of the original run the ratings hovered around 9%-10%.[132][133]Dragon Ball Z Kai premiered on Nicktoons in May 2010 and set the record for the highest-rated premiere in total viewers, and in tweens and boys ages 9–14.[134] Nielsen Mega Manila viewer ratings ranked Dragon Ball Kai with a viewer ratings with a high of 18.4% for October 30 – November 4 in 2012.[135] At the end of April 2013, Dragon Ball Kai would trail just behind One Piece at 14.2%.[136]Broadcasters' Audience Research Board ranked Dragon Ball Z Kai as the second most viewed show in the week it debuted on Kix.[137] On its debut on Vortexx, Dragon Ball Z Kai was the third highest rated show on the Saturday morning block with 841,000 viewers and a 0.5 household rating.[138]

Merchandising[edit]

Some Dragon Ball staction figures at the Romics 2015, Italy

Dragon Ball Z merchandise was a success prior to its peak American interest, with more than $3 billion in sales from 1996–2000.[139] In 1996, Dragon Ball Z grossed $2.95billion in merchandise sales worldwide.[140] As of January 2012, Dragon Ball Z grossed $5billion in merchandise sales worldwide.[112]

In 1998, Animage-ine Entertainment, a division of Simitar, announced the sale of Chroma-Cels, mock animation cels to capitalize on the popularity of Dragon Ball Z.[141] The original sale was forecasted for late 1998, but were pushed back to January 12, 1999.[142]

An acrylic replica of the Five-Star Dragon Ball.

In 2000, MGA Entertainment released more than twenty toys, consisting of table-top games and walkie-talkies.[143]Irwin Toy released more than 72 figures consisting of 2-inch and 5 inch action figures, which became top-selling toys in a market dominated by the Pokémon Trading Card Game.[144] Irwin Toys would release other unique Dragon Ball Z toys including a battery powered Flying Nimbus Cloud which hovered without touching the ground and a die-cast line of vehicles with collector capsules.[145] In June 2000, Burger King had a toy promotion which would see 20 million figurines; Burger King bore the cost of the promotion which provided free marketing for Funimation.[139] The Halloween Association found Dragon Ball Z costumes to be the fourth most popular costumes in their nationwide survey.[146]

In December 2002, Jakks Pacific signed a three-year deal for licensing Dragon Ball Z toys, which was possible because of the bankruptcy of Irwin Toy.[147] Jakks Pacific's Dragon Ball Z 5-inch figures were cited as impressive for their painting and articulation.[148]

In 2010, Toei closed deals in Central and South American countries which included Algazarra, Richtex, Pil Andina, DTM, Doobalo and Bondy Fiesta.[149] In 2012, Brazil's Abr-Art Bag Rio Comercio Importacao e Exportacao closed a deal with Toei.[150]

Notes[edit]

  1. ^Shuki Levy and Kussa Mahehi (Haim Saban) were credited as composers for contractual reasons. This was standard practice at Saban Entertainment during the 1990s.
  2. ^The original interview was conducted by Steve Harmon with Funimation CEO Gen Fukunaga in 1999 and was hosted on Harmon's personal website 'The Vault'. A record of the website exists on Archive.org, but the original interview itself was lost. The record was kept by Chris Psaros who provided a copy for the website 'The Dragon Ball Z Otaku Alliance' which republished the original interview for this source.
  3. ^Steven Simmons, who uses the nickname 'Daimao' in websites like Toriyama.org, wrote the original scripts for the Funimation subtitles and was involved in the localization process. His comments are included as a primary source, but also definitively illustrate concerns with the subtitles, from its creator. This connection and background is noted at the accompanying Anime News Network reference.
  4. ^The releases for both The Dark Prince Returns and Babidi: Showdown were released on September 25, 2001. The title 'Showdown' was replaced with 'Rivals' and contains episodes 229–231, titled 'Vegeta's Pride', 'The Long Awaited Flight', and 'Magic Ball of Buu'. Prior to the release, Billboard and news outlets including the Anime News Network and Anime Nation were using the title 'Showdown'; but the UPC codes match, indicating a re-titling for this release, 'Rivals', also has a September 25, 2001, release date for the uncut material.

Dbz Big Green Dub Songs

  1. ^Dragon Ball Kai (ドラゴンボール改 (カイ)Doragon Bōru Kai, lit. Dragon Ball Revised), retitled Dragon Ball Z Kai in most international releases

References[edit]

  1. ^'Dragon Ball Z'. Funimation. Archived from the original on August 13, 2018. Retrieved August 13, 2018.
  2. ^'Dragon Ball Z, Vol. 1'. Viz Media. Retrieved August 12, 2019.
  3. ^'Dragon Ball'. Toei Animation USA. Retrieved January 8, 2017.
  4. ^'深夜アニメの製作資金は約3億円…儲ける仕組みや製作委員会の構造とは 今こそ知っておきたいアニメビジネスの特徴を取材'. Social Game Info (in Japanese). June 17, 2016. Retrieved January 24, 2019.
  5. ^'Kazuhiko Torishima On Shaping The Success Of 'Dragon Ball' And The Origins Of 'Dragon Quest''. Forbes. October 15, 2016. Retrieved October 23, 2016.
  6. ^'Shonen Jump'. October 3, 2003: 92–97.
  7. ^Clements, Jonathan; Helen McCarthy (September 1, 2001). The Anime Encyclopedia: A Guide to Japanese Animation Since 1917 (1st ed.). Berkeley, California: Stone Bridge Press. pp. 101–102. ISBN1-880656-64-7. OCLC47255331.
  8. ^Editors' roundtable, Jump Comics (Shueisha), July 2, 2004, page 88. ISBN4088737059
  9. ^DRAGON BALL 大全集 3: TV ANIMATION PART 1 (in Japanese). Shueisha. 1995. pp. 202–207. ISBN4-08-782753-4.
  10. ^ abDragon Ball Supplemental Daizenshuu: TV Animation Part 3, pages 107–113
  11. ^DRAGON BALL 超全集 4 超事典. Shueisha. 2013. pp. 340–345. ISBN978-4-08-782499-5.
  12. ^Erickson, Hal (2005). Television cartoon shows: an illustrated encyclopedia, 1949 through 2003. McFarland & Co. pp. 283–285.
  13. ^ abDragon Ball Z end credits (FUNimation/Saban dub, 1996)
  14. ^ ab'2014 interview with Ron Wasserman'. Marvel.com. Retrieved February 8, 2016.
  15. ^ abc'Pioneer announces last Dragonball Z release'. Anime News Network. November 14, 1998. Retrieved May 27, 2013.
  16. ^Dragon Ball Z Funimation/Saban dub, episodes 1-53 (1-67 uncut)
  17. ^Cynthia Littleton. 'Saban trims syndie arm'. Variety. Retrieved March 2, 2016.
  18. ^'Dragon Ball Z to air in Kids WB'. DBZN. July 18, 2001. Retrieved September 20, 2013.
  19. ^ abDe La Cruz, Edwin (November 23, 2003). ''Dragon Ball Z' keeps up the momentum'. Video Store. Questex Media Group, Inc. Archived from the original on November 5, 2013. Retrieved June 20, 2013 – via HighBeam Research.
  20. ^'Previously Unreleased Dragon Ball Z DVDs!'. ICV2. Retrieved June 20, 2013.
  21. ^'Funimation 2005 Plans'. Anime News Network. December 31, 2004. Retrieved September 14, 2008.
  22. ^'DBZ uncut on Cartoon Network'. Anime News Network. June 9, 2005. Retrieved September 14, 2008.
  23. ^'Funimation to Stream Dragon Ball Z in North America'. Anime News Network. January 3, 2011. Retrieved January 3, 2011.
  24. ^Dragon Ball Z end credits (Westwood Media dub, c. 2001)
  25. ^Rupert Howe, Made in Japan: Chasing the Dragon ; Pokemon Was Nicknamed 'Kiddie Crack' but a New Wave of Japanese Monsters Threatens to Be Even More Addictive. The Independent (London), March 5, 2000.
  26. ^Dragon Ball Z Kai, retrieved October 19, 2018
  27. ^ ab'Japan's Remastered DBZ to Be Called Dragon Ball Z Kai'. Anime News Network. February 19, 2009. Retrieved February 21, 2009.
  28. ^'Dragon Ball Z to Rerun on Japanese TV in HD in April'. Anime News Network. February 6, 2009. Retrieved February 21, 2009.
  29. ^'「ドラゴンボールZ」放送開始20周年記念! HDリマスター坂で テレビアニメが堂々復活!! 孫悟空伝説再び!! その名も.. DRAGON BALL KAI'. V Jump (in Japanese). Japan: Shueisha: 10. February 9, 2009.
  30. ^Interview de l’éditeur de Dragon Ball — L’influence de Dragon Ball — Partie 6 (web video). Kazé. January 17, 2015. Event occurs at 6:27. Retrieved May 29, 2017.
  31. ^ドラゴンボール改 人造人間・セル編 15 [Dragon Ball Kai Artificial Human/Cell Volume 15 (DVD)] (in Japanese). Happinet Pictures. Archived from the original on April 27, 2011. Retrieved May 23, 2011.
  32. ^'Dragon Ball Z Kai's Japanese Cast Records New Episodes'. Anime News Network. November 6, 2012. Retrieved November 11, 2012.
  33. ^ ab'New Dragon Ball Z Kai Anime Series to Premiere on April 6'. Anime News Network. February 17, 2014. Retrieved February 17, 2014.
  34. ^Dragon Ball Z Kai: The Final Chapters Listed at 69 Episodes. Anime News Network (April 17, 2014). Retrieved on May 12, 2014.
  35. ^Navarre Reveals Funimation's Dragon Ball Kai License -- Anime News Network (Received February 2, 2010)
  36. ^Heldenfelds, Rich (March 11, 2010). 'Nickelodeon Announces Fall Plans'. Ohio.com. Akron Beach Journal. Retrieved September 5, 2012.
  37. ^'Dragon Ball Z Kai to Air on TheCW4Kids on Saturdays'. Anime News Network. April 26, 2010. Retrieved April 26, 2010.
  38. ^'Dragon Ball Z Kai to Run on Adult Swim's Toonami Block'. Anime News Network. May 24, 2014. Retrieved May 26, 2014.
  39. ^'Dragon Ball Z Kai Gets an Extra Slot on Adult Swim'. Anime News Network. Retrieved February 20, 2015.
  40. ^'Dragon Ball Z Kai now broadcast in the UK TOEI Animation Europe'. Toei-animation.com. November 19, 2012. Retrieved November 23, 2012.
  41. ^'Dragon Ball Z Kai Due on U.K. Television This Month'. Anime News Network. November 20, 2012. Retrieved November 23, 2012.
  42. ^'Dragon Ball Z Kai TV Screenings on Kix! Channel in Early 2013'. Anime News Network. December 11, 2012. Retrieved April 22, 2013.
  43. ^'Kyle Herbert, Sean Schemmel Returning in Dragon Ball Z Kai Buu Saga Dub'. Anime News Network. April 24, 2013. Retrieved November 11, 2013.
  44. ^'Australia's Madman Ent: DBZ Kai's Buu Saga Should Come in 2014'. Anime News Network. November 23, 2013. Retrieved February 17, 2014.
  45. ^'Funimation Has Not Recorded a Dub for Dragon Ball Z Kai's Buu Saga'. Anime News Network. February 17, 2014. Retrieved May 6, 2015.
  46. ^Funimation (December 6, 2016). 'Dragon Ball Z Kai: The Final Chapters heading to Toonami!'. www.funimation.com. Funimation. Retrieved December 8, 2016.
  47. ^ ab'Reprinted Interview: 30-Something Questions with Gen Fukunaga'. Archived from the original on August 19, 2003. Retrieved June 20, 2013.
  48. ^Dragon Ball Z: Ultimate, Battle 22, TOSE Software Co., 1995
  49. ^'What Is Dragon Ball Kai? Part II: How to Watch Kai in America'. Toon Zone. Retrieved June 21, 2013.
  50. ^'Cartoon Network Debunks Dragon Ball Z Kai Uncensored Airing Rumor'. Anime News.biz. Archived from the original on January 21, 2012. Retrieved June 21, 2013.
  51. ^'DBZ Subtitling article'. Anime News Network. Retrieved May 27, 2013.
  52. ^ ab'Concerning the DVDs (07/26/00) (Archived by Archive.org)'. Toriyama.org. Archived from the original on October 21, 2000. Retrieved May 28, 2013.
  53. ^オープニング&エンディングテーマが決定! (in Japanese). Toei Animation. Archived from the original on April 15, 2009. Retrieved April 15, 2006.
  54. ^'チームドラゴン fromAKB48 : チームドラゴン from AKB48、『ドラゴンボール改』ED曲を全11種類のパッケージで発売 / BARKS ニュース'. Barks (in Japanese). June 1, 2007. Retrieved May 31, 2007.
  55. ^'Toei Replaces Possibly Infringing Dragon Ball Kai Music'. Anime News Network. March 10, 2011. Retrieved March 14, 2011.
  56. ^'Shino Kakinuma Replaces Yuko Minaguchi as Videl in Dragon Ball Z Kai'. Anime News Network. March 10, 2014. Retrieved March 10, 2014.
  57. ^'Rock Band Good Morning America Performs New Dragon Ball Kai Ending'. Anime News Network. March 3, 2014. Retrieved May 6, 2015.
  58. ^'Leo Ieiri Performs 2nd Dragon Ball Z Kai Anime's Ending Theme'. Anime News Network. June 18, 2014. Retrieved May 6, 2015.
  59. ^''Dragon Ball Kai' New ED Song PV by Czecho No Republic'. Crunchyroll. November 1, 2014. Retrieved May 6, 2015.
  60. ^'Girl Band Gacharic Spin to Perform New Dragon Ball Z Kai Ending'. Anime News Network. March 10, 2015. Retrieved May 6, 2015.
  61. ^'Bruce Faulconer'. IMDb. Retrieved July 6, 2019.
  62. ^'DRAGON BALL Z 第1巻 [DVD]'. Amazon.com. Retrieved February 16, 2014.
  63. ^'DRAGON BALL Z ♯49 [DVD]'. Amazon.com. Retrieved February 16, 2014.
  64. ^'Dragon Ball Z news'. Anime News Network. Retrieved May 27, 2013.
  65. ^'Dragonball Z, Vol. 1: Arrival [VHS]'. Amazon.com. Retrieved February 16, 2014.
  66. ^'Dragon Ball Z — Super Saiyan (Vol. 17)(Episodes 50-53) [VHS]'. Amazon.com. Retrieved February 16, 2014.
  67. ^'Dragonball Z, Vol. 1 – Arrival (1999)'. Amazon.com. Retrieved February 16, 2014.
  68. ^'Dragonball Z, Vol. 17 – Super Saiyan (1999)'. Amazon.com. Retrieved February 16, 2014.
  69. ^'Dragon Ball Z — The Saiyan Conflict (Boxed Set I — Episodes 1-25) [VHS]'. Amazon.com. Retrieved February 16, 2014.
  70. ^'Dragon Ball Z — The Namek Saga (Boxed Set II — Episodes 26-53) [VHS]'. Amazon.com. Retrieved February 16, 2014.
  71. ^'Dragon Ball Z — The Saiyan Conflict (Boxed Set I — Episodes 1-25)'. Amazon.com. Retrieved February 16, 2014.
  72. ^'Dragon Ball Z — The Namek Saga (Boxed Set II — Episodes 26-53)'. Amazon.com. Retrieved February 16, 2014.
  73. ^'Dragonball Z, Vol. 18 – Captain Ginyu: Assault [VHS]'. Amazon.com. Retrieved February 16, 2014.
  74. ^'Dragonball Z, Vol. 18 – Captain Ginyu: Assault (Uncut) [VHS]'. Amazon.com. Retrieved February 16, 2014.
  75. ^'Dragon Ball Z: Kid Buu — New Beginning [VHS]'. Amazon.com. Retrieved February 16, 2014.
  76. ^'Dragonball Z, Vol. 18 – Captain Ginyu: Assault'. Amazon.com. Retrieved February 16, 2014.
  77. ^'Dragon Ball Z — Kid Buu — A New Beginning'. Amazon.com. Retrieved February 16, 2014.
  78. ^'DragonBall Z: Vegeta Saga 1 – Saiyan Showdown ( Vol. 1 )'. Amazon.com. Retrieved February 16, 2014.
  79. ^'DragonBall Z: Vegeta Saga 2 – Saiyan Invasion ( Vol. 1 )'. Amazon.com. Retrieved February 16, 2014.
  80. ^'Dragon Ball Z: Season One (Vegeta Saga)'. Amazon.com. Retrieved February 16, 2014.
  81. ^'Dragon Ball Z: Season Nine (Majin Buu Saga)'. Amazon.com. Retrieved February 16, 2014.
  82. ^'Funimation Entertainment Announces First U.S. Release of Dragon Box' (Press release). Funimation. July 20, 2009. Archived from the original on September 15, 2009. Retrieved August 28, 2009.
  83. ^'FUNIMATION ENTERTAINMENT ANNOUNCES DRAGON BALL Z SERIES ON BLU-RAY'. funimation.com. Archived from the original on March 5, 2016.
  84. ^FUNimation Entertainment (July 21, 2011). 'FUNimation Entertainment Announces Dragon Ball Z Series on Blu-ray'. prnewswire.com.
  85. ^'FUNimation Entertainment Announces Dragon Ball Z Series on Blu-ray — FLOWER MOUND, Texas'. Texas: Prnewswire.com. July 21, 2011. Retrieved August 10, 2011.
  86. ^Funimation Entertainment (January 26, 2012). 'FUNimation Suspends Production of Dragon Ball Z Blu-rays' (Press release). Flower Mound, Texas: Anime News Network. Retrieved January 26, 2012.
  87. ^'Dragon Ball Z: Season 9 [Blu-ray]'. Amazon.com. Retrieved November 8, 2014.
  88. ^'Dragon Ball Z: Rock the Dragon Collector's Edition (2013)'. Amazon.com. Retrieved February 16, 2014.
  89. ^Hodgkins, Crystalyn (March 3, 2019). 'Funimation Reveals Plans for New Dragon Ball Z BD Collector's Edition if it Receives 2,500 Pre-Orders'. Anime News Network. Retrieved April 14, 2019.
  90. ^Funimation [@FUNimation] (April 5, 2019). 'The Dragon Ball Z 30th Anniversary collector's edition is now available to preorder! See EVERYTHING this amazing set has to offer: funi.to/DBZ30th Oh, and yes.. it's in 4:3. 🔥🔥🔥 #DBZ30th' (Tweet). Retrieved April 14, 2019 – via Twitter.
  91. ^Peters, Megan (March 18, 2019). ''Dragon Ball Z' 30th Anniversary Collection Ups Pre-Order Minimum'. ComicBook.com. Retrieved April 14, 2019.
  92. ^'Why Do Funimation's Dragon Ball Z Re-Releases Look Like That? - Answerman'. Anime News Network. April 17, 2019. Retrieved April 18, 2019.
  93. ^Valdez, Nick (April 8, 2019). ''Dragon Ball Z' Fans Are Worried About the 30th Anniversary Collector's Edition Set'. ComicBook.com. Retrieved April 14, 2019.
  94. ^'How the Dragon Ball Z 30th Anniversary Collector's Edition 4:3 aspect ratio was created'. Funimation. April 9, 2019. Retrieved April 14, 2019.
  95. ^'Dragon Ball Z Kai: Part One Blu-ray'. Amazon.com. Retrieved August 10, 2011.
  96. ^'Dragon Ball Z Kai: Part Eight [Blu-ray]'. Amazon.com. Retrieved November 8, 2014.
  97. ^'Dragon Ball Z Kai: Season 1 [Blu-ray]'. Amazon.com. Retrieved November 8, 2014.
  98. ^'Dragon Ball Z Kai: Season 4 [Blu-ray]'. Amazon.com. Retrieved November 8, 2014.
  99. ^'Dragon Ball Z Kai – The Final Chapter – Part One – Blu-ray – Home-Video'. Funimation Shop.
  100. ^The Final Chapter – Part Two – Blu-ray home-video
  101. ^The Final Chapter – Part Three – Blu-ray home-video
  102. ^'Viz announces 4/99 releases'. Anime News Network. Retrieved May 27, 2013.
  103. ^'Viz announces products for 7/99 release'. Anime News Network. Retrieved May 27, 2013.
  104. ^'March Manga releases'. Anime News Network. Retrieved May 27, 2013.
  105. ^'Releases from Viz posted on November 2, 2000'. Anime News Network. Retrieved May 29, 2013.
  106. ^'Dragon Ball Z, Vol. 1 (VIZBIG Edition)'. Barnes & Noble Booksellers, Inc. Retrieved January 20, 2017.
  107. ^'Dragon Ball (3-in-1 Edition), Vol. 1'. Amazon.com. Retrieved January 24, 2016.
  108. ^'Atari and FUNimation Extend Dragon Ball License'. Wireless News. Close-Up Media, Inc. January 11, 2005. Archived from the original on May 5, 2016. Retrieved May 28, 2013 – via HighBeam Research.
  109. ^ ab'Atari Settles 'Dragonball Z' (ALL) Dispute With FUNimation'. Worthplaying. Retrieved May 29, 2013.
  110. ^'Namco Bandai Locks Down Dragon Ball License For America'. Kotaku. Retrieved May 28, 2013.
  111. ^Erickson, Hal (2005). Television cartoon shows: an illustrated encyclopedia, 1949 through 2003. McFarland & Company. p. 284. ISBN978-0-7864-2255-5. Introduced in Japan as Doragon boru Z in 1989, the property was successful enough in anime form, but the attendant merchandising of toys, action figures and video games went through the roof; within ten years, profits in Asia alone totaled $3 billion.
  112. ^ ab'Funimation January 2012 Catalog'(PDF). thecnl.com. Retrieved July 30, 2017.
  113. ^Dhiman, Govind (July 30, 2019). 'Watch Dragon Ball Super- #1 Anime Without Fillers'. Hi Tech Gazette. Retrieved July 30, 2019.
  114. ^'78. Dragon Ball Z'. IGN. January 23, 2009. Retrieved September 25, 2016.
  115. ^'Wizard Magazine's Top 100 cartoons list'. Listal. Retrieved April 30, 2011.
  116. ^'Wizard lists Top 50 Anime'. Anime News Network. July 6, 2001. Retrieved February 2, 2014.
  117. ^Azoulay, Julia F (June 1, 2001). 'Character study: CB offers a licensing show cheat sheet'. Children's Business. Conde Nast Publications, Inc. Archived from the original on November 5, 2013. Retrieved May 28, 2013 – via HighBeam Research.
  118. ^Evers, Joris (December 20, 2000). 'Britney Spears tops Lycos 2000 search terms list'. Network World. Network World Inc./IDG. Archived from the original on November 5, 2013. Retrieved May 1, 2013 – via HighBeam Research.
  119. ^Phan, Monty (January 14, 2001). 'Ugh, they did it again -- and again'. Post-Tribune (IN). Sun-Times News Group. Archived from the original on November 5, 2013. Retrieved May 28, 2013 – via HighBeam Research.
  120. ^Schorow, Stephanie (January 8, 2002). 'Predictably, Nostradamus tops searches on Internet'. The Boston Herald. Herald Media, LLC. Archived from the original on November 5, 2013. Retrieved May 1, 2013 – via HighBeam Research.
  121. ^Erickson, Hal (2005). Television cartoon shows: an illustrated encyclopedia, 1949 through 2003. McFarland & Company. p. 284. ISBN978-0-7864-2255-5.
  122. ^Makuch, Eddie (December 30, 2015). 'Watch These Bizarre Ford Car Commercials Featuring Dragon Ball Z'. GameSpot. Retrieved December 27, 2016.
  123. ^'Behind the Screens'. Electronic Gaming Monthly. No. 98. Ziff Davis. September 1997. p. 118.
  124. ^'Gundam Wing leaving Toonami?!'. Anime News Network. December 12, 2000. Retrieved November 29, 2008.
  125. ^'Dragonball Z Tops Ratings'. Anime News Network. September 22, 2002. Retrieved May 26, 2014.
  126. ^Reynolds, Mike (February 26, 2001). 'Cartoon Upfront With New Show Spending'. Cable World. Access Intelligence, LLC. Archived from the original on October 11, 2013. Retrieved May 1, 2013 – via HighBeam Research.
  127. ^Stump, Matt (April 23, 2001). 'Broadband 'Toonami' Boosts Cable Modems'. Multichannel News. NewBay Media LLC. Archived from the original on October 11, 2013. Retrieved May 1, 2013 – via HighBeam Research.
  128. ^The Associated Press. (October 12, 2001). 'Most Popular Videos'. AP Online. Press Association, Inc. Archived from the original on May 5, 2016. Retrieved May 1, 2013 – via HighBeam Research.
  129. ^'Japanese Anime TV Ranking, March 30-April 5'. Anime News Network. April 13, 2009. Retrieved April 29, 2009.
  130. ^'Japanese Anime TV Ranking, April 6–12'. Anime News Network. April 16, 2009. Retrieved April 29, 2009.
  131. ^'Japanese Anime TV Ranking, April 13–19'. Anime News Network. April 22, 2009. Retrieved April 29, 2009.
  132. ^'海外で話題の日本アニメをソーシャルメディアから探る! ~「ワンピース」が各国のつぶやきで上位に~'. Videor.co.jp. Archived from the original on March 3, 2016. Retrieved June 20, 2013.
  133. ^'バックナンバー2011年度 VOL.6 2011年 1月31日(月) ~ 2月6日(日)'. Videor. Archived from the original on February 18, 2011. Retrieved June 20, 2013.
  134. ^'Nickelodeon Ranks As Basic Cable's Top Network With Kids, Total Viewers; Scores Most-Watched May Ever With Total Viewers'. Viacom. June 2010. Archived from the original on June 6, 2010. Retrieved June 20, 2013.
  135. ^'AGB Nielsen Mega Manila Household Ratings (Oct. 30-Nov. 4): Be Careful With My Heart rules daytime; 24 Oras and Ina Kapatid Anak share primetime lead'. Pep. Archived from the original on March 6, 2016. Retrieved June 20, 2013.
  136. ^'AGB Nielsen Mega Manila Household Ratings (April 26 to 28): Aljur Abrenica's Magpakailanman episode tops Saturday ratings'. PEP. Archived from the original on October 31, 2014. Retrieved June 20, 2013.
  137. ^'Viewing data Top 10s'. Broadcasters' Audience Research Board. Retrieved April 13, 2014.
  138. ^'Saturday Morning Vortexx Ratings Notes for the CW: 'WWE Saturday Morning Slam', 'Dragon Ball Z Kai', 'Justice League Unlimited' & More'. TV By the Numbers. Retrieved May 26, 2014.
  139. ^ ab'Burger King Uses Kids' Meals to Promote Japanese Cartoon Series.(Knight Ridder/Tribune Business News)'. Knight Ridder/Tribune Business News. June 5, 2000. Archived from the original on November 5, 2013. Retrieved May 1, 2013.
  140. ^'Manga, anime rooted in Japanese history'. The Indianapolis Star. August 2, 1997.
  141. ^'Ani-Mag announces Chroma-Cels of Sailor Moon, DBZ'. Anime News Network. Retrieved May 27, 2013.
  142. ^'News Briefs (posted on December 12, 1998)'. Anime News Network. Retrieved May 27, 2013.
  143. ^'MGA signs for Dragonball Z.(Brief Article)'. Playthings. January 1, 2000. Archived from the original on November 5, 2013. Retrieved May 1, 2013.
  144. ^Cuthbert, Joyce (February 1, 2000). 'Chicago'. Playthings. Furniture Today Media Group LLC. Archived from the original on November 5, 2013. Retrieved May 1, 2013 – via HighBeam Research.
  145. ^'Irwin Toy Launches'. Anime News Network. Retrieved May 27, 2013.
  146. ^'The Hype All Dressed up with Somewhere to Go'. Los Angeles Daily News. McClatchy-Tribune Information Services. October 25, 2000. Archived from the original on November 5, 2013. Retrieved May 1, 2013 – via HighBeam Research.
  147. ^Hopkins, Brent (February 19, 2003). 'Toy Maker Bets on Dead Delinquent Jakks Pacific Shifts Its Focus from Wrestling'. Los Angeles Daily News. McClatchy-Tribune Information Services. Archived from the original on November 5, 2013. Retrieved May 28, 2013 – via HighBeam Research.
  148. ^Bump on Head Does Good for Warrior, Target Earth, Joseph Szadkowski, The Washington Times (Washington, DC), December 3, 2005 Questia
  149. ^'Toei seals Latin America deals'. Licensing.biz. Archived from the original on January 12, 2012. Retrieved May 28, 2013.
  150. ^'Toei lands licensing deal for Dragon Ball Z'. Kidscreen. Retrieved May 28, 2013.

Further reading[edit]

Dbz Big Green Dub Season 2

  • Mínguez-López, Xavier (March 2014). 'Folktales and Other References in Toriyama's Dragon Ball Z'. Animation. 9 (1): 27–46. doi:10.1177/1746847713519386. hdl:10550/44043.

External links[edit]

Wikiquote has quotations related to: Dragon Ball Z
  • Official website(in English)
  • Official website(in Japanese)
  • Dragon Ball Z on IMDb(in Japanese)
  • Dragon Ball Z on IMDb(in English)
  • Dragon Ball Z (anime) at Anime News Network's encyclopedia


Retrieved from 'https://en.wikipedia.org/w/index.php?title=Dragon_Ball_Z&oldid=912751172'

http://tvtropes.org/pmwiki/pmwiki.php/Narm/DragonBall

Dbz Super Episode 1 English Dub

There are subjectives, and then there are these. While you may believe a work fits here, and you might be right, people tend to have rather vocal, differing opinions about this subject.
Please keep these off of the work's page.

Go To

  • Dragon Ball Z's 'It's over NINE THOUSAND!', thanks to Memetic Mutation, has become one of the most (in)famous pieces of Narm of all time. While the Ocean Group version of the line is better known, the Funimation version (which is the version Team Four Star chose to parody) is pretty silly itself, although that might have been done on purpose to lightly parody the original version.
  • This odd conversation in the Ocean dub. Nappa's face doesn't help.
    Vegeta: Nappa, remind me to look into having you dewormed again.
    Nappa: (smiling) I don't have worms!
  • Advertisement:
  • Cell's reaction to Goku giving him a Senzu bean before fighting Gohan during the Cell Games: 'Thank you Goku, I will take this bean without hesitation!' It's the Motor Mouth delivery that sells it.
  • The sheer amount of ridiculous edits and dialogues done in the Ocean dub just to cover up the deaths, regardless of logic, caused it to become a full-on So Bad, It's Good comedy because of how ridiculous it is.
    • Every time a character threatens to send someone 'to another dimension!'
      • Well, except for that one time Vegeta made it sound badass:
      Vegeta: Maybe you won't be such a disappointment.. in the next dimension!
      • Ironically, the redubbed line fits this trope despite the aversion of Never Say 'Die'.
      Vegeta: Maybe you won't be such a disappointment.. when you're dead!
    • When Nappa decides to blow up an entire city full of people, he claims that all of the inhabitants have somehow evacuated despite the fact that previously there were a load of baffled crowds watching them. In two seconds? Talk about Outrunning the Fireball.
    • Advertisement:
    • When Nappa destroys a plane full of people which we explicitly see, they couldn't pull the 'Cargo Robot' excuse, so they covered it up with Tien claiming that he saw parachutes, so they're okay; however, there's nothing resembling a parachute in the sky, let alone a sign that they made it out alive. Perhaps Tien needed a fourth eye to see one. Or his third eye can only see bullshit.
    • Nappa saying 'Bus stop to the next dimension!' during his fight with the Z Warriors. Maybe Goku should've taken the bus to and from King Kai's.
    • There's also Goku's 'realization' upon seeing Vegeta's Great Ape form. Why the quotation? It's because in this version, Goku apparently believes that Vegeta is the one who destroyed the World Tournament arena and killed his grandfather. Putting aside the huge amount of Fridge Logic that comes out of this, this Bowdlerisation turns the critical moment from Goku realizing that he was the one responsible for Grandpa Gohan's death into a Never My Fault moment.
  • This line from Trunks from the English dub of Z:
    'If they set that android free, it will be the end of all of uuuuuuus! NOOOOOOOO!!!'
      Advertisement:
    • Even Narmier in the Ocean Dub version, which sounds like it's poking fun at the Funimation line.
      'If that android is set free, it will be the END OF US ALLLLLLLL! NOOOOOOOOOO!
  • Many English speaking fans consider Adult!Goku's Japanese voice Narmful, finding it dissonant to hear a full-grown martial artist (who's a grandfather in the end) speaking with almost the exact same voice he had as a twelve-year old. This is intentional, however.
    • Masako Nozawa voicing adult Son Goku with almost the exact same voice he had as a twelve-year old is uniquely charming. Masako Nozawa voicing his father Bardock is just egregious. A hardened, ruthless Saiyan warrior sounding like.. this? That's so unfitting, it's hilarious!
    • In the end, she's the Seiyuu for every male member of the Son family except for Goku's brother Raditz, who has a deep baritone voice. Maybe Raditz isn't related to Goku after all! Even funnier is that she even voices Turles who, other than looking like Goku, has absolutely nothing to do with him!
  • Frieza tries to intimidate Krillin:
    Frieza: You cut off my tail, you imbecile, and now I'm going to eat you!
  • The AB Groupe dub, better known for as the 'Big Green' dub, is infamous for its awfulness, being the very definition of a 'Blind Idiot' Translation, and being hilarious for all the wrong reasons.
    • The Dead Zone movie has this line from Garlic Jr. when Kami appears to confront him:
    • From the same version, Garlic Jr's Spice Boys are impossible to take seriously. While there's an element of parody with most evil minions in the Dragon Ball franchise, giving one of them a voice that sounds like an evil version of Fozzie Bear doesn't help much.
    • Chewing the Scenery is a must in the Z movies, especially from villains.
    • Clearin completely forgets who the tall green alien guy that's fought alongside him since the start of the series is. What was his name again?
    • A lot of what the narrator says are Blatant Lies.
      [From 'Cooler's Revenge']
      Narrator: Goku's father, Bardock, showed up just in time to foil [Freezer's] plans and take him on in hand-to-hand one-on-one combat. It's no holds barred and neither one will leave this fight unhurt.
      [From 'The History of Trunks']
      Narrator: Big Green had perished. Vegetuh, Yamcha, Tenshin, and Clearin, they had survived.
    • Motor Mouth is a serious disease in this dub. Take this clip for example.
      Paragus: I must tell you mykeenestdesirehasalwaysbeentocreateanewPlanetVegetuhafterFreezerdestroyedouroldonethirtyyearsagoyouwillrecall. *deep breath* IknewitwouldbetheonlywaytoperpetuatethereignofKingVegetuhyourfatherkilledbyFreezerinhumiliatingcircumstances *small breath* nowthatIconvincedyouandbroughtyouhere. I can tell you that my sacredmissionmygreatdreamwillatlasttakeshape and be realized.
    • And even when he's not Motor Mouthing, Paragus has some..issues with inflection. And run-on sentences.
    Paragus: Is it possible the sensed power of Kakaroetoh, called Goku, has awakened the spirit of Space Warrior within you, and made you impossible to control, and all of my work was for nuh, thing?!
    • The fact that every super power in the AB Groupe dub is inexplicably referred to as a Kamehameha. Kaioken? That's now a Kamehameha. Throwing a Spirit Bomb? Kamehameha. Even the act of transforming into a Super Saiyan- sorry, Super Space Warrior- sorry, Space Super Warrior is a Kamehameha now!
  • Goku's five minute transformation into Super Saiyan 3 is also rather infamous. Awesome, yes, but infamous.
  • Super Saiyan Goku's 'I am' speech in the original Funimation dub of Z is hilariously bad. Not only because of the cheesy writing, but because it took the original point of the speech (Goku finally embracing his Saiyan heritage and making it clear that he's not fighting for fun, but to kill Frieza), chucked it out of the window and replaced it with a generic, gaudy 'I'm better than you because I'm the good guy' speech lifted straight out of an old Superman comic.
    Goku: I am the Hope of the Universe. I am the answer to all living things that cry out for peace. I am protector of the innocent. I am the light in the darkness. I am truth. Ally to good! Nightmare to you!
    • Hell, every instance of Adaptational Heroism in the dub is this. It was apparent in the Japanese version to a certain extent, but the original English dub straight-up turned Goku into a Supermanexpy for fear that Goku's actual character might be a turn-off for western audiences. Hearing all these lines in narration and spoken dialogue about how Goku is a 'protector of the innocent' with not a single bad bone in his body becomes all the harder to take seriously when you know how Goku actually operates. Unsurprisingly, Funimation consider the original dub an Old Shame and have since made their dub of Dragon Ball Kai more accurate, with Goku's proper characterization in mind.
  • The way Frieza is beaten by Goku on Namek. As Goku is flying off and leaving the bisected Frieza behind, Frieza starts screaming 'I will make you pay for opposing the MOST POWERFUL BEING IN THE UNIVEEEEEEEEEEERSE!' and shooting a beam of energy at Goku. Goku turns around, screams 'YOU FOOOOOL!', and blasts it back. Then Frieza's face and the way he's screaming makes it look like he's having an Immodest Orgasm. Also, Frieza says that he's 'the most powerful being in the universe' about five times throughout that scene despite the fact that he's dying.
  • Before that, there was the scene in which Frieza sent one of his Death Saucers at Goku. The camera spins around and around him while he's laughing.
  • 'You think I'm stupid enough to fall for such a childish TRICK?!!!!' The way Frieza screams 'trick' and the way his eyes bug out are hilarious.
  • This line by Captain Ginyu in the original dub as Goku is powering up to what was then considered insane levels.
    Ginyu: 'One hundred thousand?! Ay-yi-yi! I wasn't counting on this!'
  • Also during the Frieza Saga: Vegeta awakens from a much-needed nap and then finds the Dragon Balls missing and the dragon summoned. His reaction to the sight of the monstrous Porunga in the initial dub? To proclaim 'Holy Cosmos!' and 'That's one whopper of a lizard!'
    • Really, Vegeta in the early days of Funimation's dub was full of narm. Granted, Sabat was just starting off as Vegeta, but his Brian Drummond impression practically reeked with narm. Thank goodness he eventually found a more unique and better voice for the Saiyan prince.
    • Later episodes would give us such gems as 'Great galaxies!' and 'Son of a Namek!'
  • Vegeta's best comeback ever:
    Android 18: How sad, to work so hard for.. so little.
    Vegeta:SAD FOR YOUUUUUU!!!
  • And this is Vegeta's second best comeback ever, from GT.
    Super 17: I have to admire your ability to get up after a hit like that.
    Vegeta: And I admire your ability to DIE!
  • A notable gem in the English dub is when Piccolo finishes his fusion with Nail. Piccolo's dialogue during this scene resembles an overexcited sports player pumping himself up.
    'Whoa, unreal! My gosh! THIS IS AMAZING! I FEEL INCREDIBLLLLLLLE!! YES! YES YES YES! I CAN WIN! I FEEL GREAT! I - CAN - DO - THIS!''
    • How does Dragon Ball Z Abridged make fun of this scene? By not changing a single thing about it. And takes it to Never Live It Down territory by referencing it during their take of Piccolo and Kami fusing.
      • Some fans, particularly newer ones (post Kai/Abridged/Super), even admitted that they were surprised when they found out that the line was spoken in the original dub, thinking that the line was a just a gag made by TFS for Abridged and not something that Piccolo actually said in the original dub.
  • When Gohan is practicing with the Z-Sword, his practice basically includes swinging it wildly over a lake. But then occasionally, he'll stop what he's doing, hold the sword over his head, point to it, and scream 'HOOOOOOOOOOOOOOOOO!'
  • Kyle Hebert's deep narrator voice can sometimes lead to Narm, like in the episode Gohan Goes To Highschool where he says in his standard, Don Lafontaine-esque tone, 'Hurry, Gohan! You'd hate to be late to class..' This is immediately followed by the title card with the standard 'guitar riff episode title' theme. Basically, a rockin' guitar riff set to white text saying 'Gohan Goes To High School'. Doubly funny because Kyle Hebert is talking about Kyle Hebert.
    • The opening narration for one of the Cell saga episodes, picking up after Cell absorbed almost the entire population of a city. It went something like this:
      'Just another ordinary, peaceful morning in a quiet little town, right? WRONG.
    • The closing narration of one episode has some narmful alliteration.
  • The English dub of Kai has Raditz shrieking 'NOW DIIIIIIIIIIIIIE!!' before trying to kill Gohan. With a scream and hair like that, he could've been the lead singer for an 80's hair metal band!
  • In GT, Vegeta's sad, sad attempt at growing a mustache. Even his daughter made fun of it.
  • And how could anybody forget this gem from the Funimation dub:
    Krillin: 'Wow! Mondo cool!'
    Vegeta: *thinking* 'That's right, boys: mondo cool.'
  • An early Funimation dub example when Goku is in Ginyu's body:
    'Uhhh.. The pain's too strong, and.. I don't think I can go o-o-o-on..'
  • Practically every other one-liner to come out of Frieza's mouth in the Funimation dub can come off as unintentionally hilarious (especially during scenes when he's supposed to be intimidating), considering how refined and eloquent he is in canon.
  • This.. moment from the Cell Saga when Cell tries to surprise Android 17 with a body slam to absorb him. It doesn't work.. Because he tries it right above the sun where 17 would notice the shadow, and Cell lets out probably the most unusual, yet hilarious roar you can think of. The Japanese music in the background only makes the entire moment sillier than it needs to be.
  • The scene used in Gogeta's introduction toward the end of Fusion Reborn is different in-between versions, 'thanks' to the English dub's Lull Destruction:
    English!Gogeta: I am not Goku nor Vegeta! I am Gogeta! It's over, Janemba! I've come for you!
  • The 'Speedy' dub (aka 'Malaysian DBZ') in its entirety. To wit, Turles encounters Gohan and tries to turn him to his side:
    Gohan: Daddy?
    Turles: Huuuh? Whaaat? I see. So you are the son of Kakarot. You inherited the blood of Saiya-People!
    Gohan: Wh-wh-wh-who are you?!
    Turles: Huuuh? I am da Saiya-People!
    Gohan: Whaaa? The Saiya-People?!
    Turles: Yaaaaas! My name is Turass! We can wander selfishly in universe destroy whatever we like.. Eat delicious food.. And drink delicious likka! There is nothing like this enjoyable life!
    • This dub even has its own Engrish version of the infamous 'Let that child alone!' line from the 'Big Green' dub:
    • Arguably, Piccolo's next line is even worse, ending with a roar that sounds like he tried to record it while gargling water.
    Piccolo: I'm not KIDDING!!!! GUAAAAUAUAAAAAAAUGHGHHHH!!!
  • More tidbits from the Speedy Dub:
    Meta-Cooler: 'You are da trash of the Namek people. You are also still alive. This is a good time. I was thinking that after I BEAT 'DIS MONKEY, I'm going to the Earth, but it cost me a trouble.'
    Meta-Cooler: At last, you show your real shapeexplanation , Saiya People. If it is not so that is uninteresting.
    Piccolo:'Goku.. now we fight each udda!'
    Piccolo:'YOUR MIND HAS BEEN DAMAGELY CORRUPTED. GET LOST!'
  • Anything Yakon does. Basically, one of the most dangerous species in the galaxy is called dumb by Goku.
    • It's just, he gives off a rapey kind of feel..
    • At the end of the fight, Yakon tries to kill Goku by eating his energy and turning into a balloon. It fails spectacularly.
  • Hey! That's my father's GALLIC Gun!
    • 'Don't forget, some of your cells compose ME!'
    • Especially how Cell fails to keep his footing.
  • This.. thing from the Greek dub.
    • Well, now we know where LittleKuriboh got the inspiration for Melvin from.
  • The ever-famous MAYBE NOOOOOT!
  • A lot of the foreign dubs are really, really bad.
  • Ocean Dub Pui Pui's voice.
    • 'It's duh gravetee! Ten times stronger than Urth.'
  • Ocean Supreme Kai's reaction to Dabura: 'DABORAAAAAAAH!'
  • You may find it difficult to take Ocean Dub Cell seriously once you assume from watching this that he might've absorbed an opera singer in his quest for power.
    • He may, in fact, possess the cells of the Portuguese dub Dodoria, who one might assume probably is voiced by an opera singer upon hearing him.
  • Vegeta shouting 'THEN THE WHOLE UNIVERSE IS GOING TO DIE!' (Video is a Youtube Poop, but it's the only video containing the scene and you can still feel the Narm pretty well).
  • It was during the 'next time' segment, but the narrator just wants you to know that KRILLIN'S IN DA HOUSE!
  • Goku mocking Piccolo for his fatal energy blast missing Goku's vital organs. Piccolo's thusly-memed response: ALL OF THEM?!
  • The History of Trunks has an opening narration that tells of how Earth's greatest warriors were all killed by the Androids: 'Piccolo was the first to try...and the first to die.' Real appropriate. Next is this little gem: 'Vegeta was next to fall. Then Yamcha and Tien. EVEN KRILLIN WAS DESTROYED BY THE RUTHLESS DUO!'Because Krillin has such asparklingrecord of cheating death.
  • And of course, let us not forget Raditz's immortal one-liner towards a freshly dismembered Piccolo.
    Ah, excuse me, has anyone seen my arm?Bwahahahahahahahaha!You can't miss it, it's green!
    • Comes in two distinctflavors for your viewing pleasure!
    • And just like the 'motivational Piccolo' scene above, Team Four Stardidn't change a damn thing about this line.
  • The scene in which Frieza beats up Vegeta while speaking calmly would've been more dramatic if it didn't have him randomly grabbing a crab and eating it.Watch it here.
  • Occasionally, the seiyuu's acting will fall flat during some especially dramatic moments:
    • In Budokai Tenkaichi 3, this is most noticeable. The player can set the game to be in either Japanese or English. The English voice actors give it their A-game, while the Japanese seiyuus just read their lines out loud. In a fighting game.
    • In Dragon Ball Super, when King Kai yells or exhibits emotion, his seiyuu delivers his lines in a flat monotone voice. Granted, the actor was pushing 86 at the time and was darrin'ed pretty soon afterwards.
  • Vegeta's Internal Monologue about how much he treated Trunks like crap is interrupted by Trunks throwing up his own blood onto the screen. Talk about Idiosyncratic Wipes!
  • On Episode 130, Vegeta takes a senzu bean from Krillin so he can power up and pursue Dr. Gero. The Brazilian dub features this exchange:
    Vegeta: *munch* *munch* ..Those idiots really enjoy wasting time.
    Vegeta: *turns super* Very well. You all can go back home and drink coffee milk. And don't interfere with the fight!
    Krillin: Ah, you miserable!.. Nobody tells us to drink coffee milk!
  • Bojack making Ineffectual Death Threats to SSJ2 Gohan despite being vastly outmatched.
  • The later Funimation dubs of the franchise often (but not always) dub the opening and ending themes into English. These can range from awesome ('Dragon Soul'), to cringeworthy ('Hello Hello Hello'), to hilariously narmful and full of incomprehensible Engrish ('Chōzetsu ☆ Dynamic!').
  • One from the original Dragon Ball: Devilman's use of the Devilmite Beam during his fight with Goku. For context, it's an attack that instantly kills whoever it's used on by taking the evil in a person's heart and exploding them from the inside. When Devilman is about to use it, Roshi explains the attack's properties all while everybody is extremely dramatic about Goku's impending death.. but Goku is pure of heart (or at least, as pure as a Saiyan child can be), something that the audience is well aware of. Everyone present except Devilman himself is aware of this, yet they act like there's a chance the attack might actually kill Goku. And the funniest part? In the anime's version of the events, he tries it again.
  • The Bang Zoom! dub of Super isn't too bad per se since it features well known voice actors like Jamieson Price and Kaiji Tang who did their best (and Wendee Lee got to reprise the role of Bulma from 20+ years ago) but while the choice of Lex Lang as Goku isn't a bad idea on paper, the result is basically this. Goku is supposed to be a super strong Book Dumb hillbilly but Lang's version of Goku goes so far with that it loops straight into Narm territory. His normal speaking voice has this odd whiny twang that tends to veer towards sounding like Morty, his Big WHAT attempt against Beerus sounds more like an imitation of a Sassy Black Woman and during battle, Goku lets out these odd battle cries that sound like he's taken up Hokuto Shinken (funny given who Lang has voiced before.) Its almost a shame they only managed to proude around 50 episodes before getting quietly cancelled.
  • The official dub of episode 111 of Super unfortunately turned Hit's elimination by Jiren into this with one major gaff: the Grand Priest declaring Hit as hailing from the 11th universe instead of the correct 6th. Jiren just betrayed his own universe!

Index